Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
united kingdom united kingdom
£0.00
ETB,s
Ersttagsblatt 1987 - 1989 CTO in album
Ersttagsblatt 1987 - 1989 CTO in album
£14.00
Ersttagsblatt 1983 - 1985 CTO in album
Ersttagsblatt 1983 - 1985 CTO in album
£14.00
Ersttagsblatt 1974 - 1976 CTO in album
Ersttagsblatt 1974 - 1976 CTO in album
£14.00
Ersttagsblatt 1978 - 1980 CTO in album
Ersttagsblatt 1978 - 1980 CTO in album
£14.00
Ersttagsblatt 1974 - 1977 CTO in album
Ersttagsblatt 1974 - 1977 CTO in album
£14.00
Ersttagsblatt 1981 - 1983 CTO in album
Ersttagsblatt 1981 - 1983 CTO in album
£14.00
Ersttagsblatt 1981 - 1983 CTO in album
Ersttagsblatt 1981 - 1983 CTO in album
£14.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Register to earnLoyalty Points
Loyalty Program
Join our VIP rewards program today!
Register to earn Loyalty Points
Points mean prizes!
Ways to earn
Welcome gift
Place an order
Write a review
Newsletter signup
see more..
Ways to redeem
% discount!
see more..
Join today
Already have an account?Sign in