GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
united kingdom united kingdom
£0.00
Germany Deutsch's Reich 50 used stamp pack

Germany Deutsch's Reich 50 used stamp pack

£10.00 inc. tax

Germany Deutsch's Reich 50 used stamp pack

free uk postage

DR26

Product Code: szEmWF4
weight: 100.0 g
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Germany Deutsch's Reich..
Germany Deutsch's Reich..
£10.00
Germany imperial to Rei..
Germany imperial to Rei..
£10.00
Germany Bohemia and Mor..
Germany Bohemia and Mor..
£10.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Register to earnLoyalty Points
Loyalty Program
Join our VIP rewards program today!
Register to earn Loyalty Points
Points mean prizes!
Ways to earn
Welcome gift
Place an order
Write a review
Newsletter signup
see more..
Ways to redeem
% discount!
see more..
Join today
Already have an account?Sign in